26,108 Free Images of Be Mobile

cc-zerouploaded with mobile/androidpages with mapsvehiclecitytrafficcityscapemedia lacking a descriptionfoodplate
Notfallzentrum Eschborn im Bau Oktober 2019 08
self-published worktown
Moscow trolleybus 9323 2020-07
vehicletraffic
Moscow trolleybus 8003 2004-02 Nagatinskaya
self-published workvehicle
Moscow trolleybus 7007 2004-02 Нижтролл
self-published workvehicle
Kingsway House
architecturetown
Kupavna railway 2020-08 2
landscapegrass
KZD VL8M-1146 2021-05 Simferopol 4
passenger trainvehicle
Iris 01 - Arlington, MA
naturespring
KZD VL10-1886 2021-05 Simferopol Passenger
self-published workvehicle
Lilac - Arlington, MA
naturespring
Lychgate to S of St. Michael's Church
architecturebetws-y-coed
Plum trees with flowers at Arisugawa Park 3
prunus domesticatree
Plant in the forest at Institute for Nature Study 3
springplants
Opel Ascona Dzankoi
vehiclecar
Pilgrims and People around the Holy shrine of Imam Reza at Niruz days - Mashhad - Khorasan - Iran 064
street scenepeople
Garden plot sign
self-published workgreen
Gare de Vichy - train de wagon citernes 2
passenger trainvehicle
Hoogwater Maas bij Bokhoven
netherlandswater
Shōshinkai 2
kadomatsuvillage
Snow removal equipment
self-published worksnow
Skulptur auf dem Egeria Platz in Tübingen von hinten
sidewalkcity
RZD VL10U-1008 2020-12
self-published workpages with maps
Smørrebrød homage 01 - anchovies, chorizo, cornichons, onion, pepper, on German rye - Massachusetts
platefood
Small shrine in Shibuya, 10 meters away from Yamanote line
self-published workcanned coffee
Simferopol trolleybus 2725 2021-05
vehiclecity
White-black-orange butterfly at Institute for Nature Study
self-published workbutterfly
View from Miyashita Park 3
vehiclecity
President Theodore Roosevelt High School
trafficmakiki
Omelet in a bag, with ham, cheddar, salsa, and guacamole - Massachusetts
platefood
US Navy 070828-N-0989H-035 Marine Corps Staff Sgt. William Sudbrock and Cpl. John Gruttadaurio, assigned to a U.S. Marine Corps mobile training team, demonstrate the proper procedures for executing a controlled fall to recruits
united states navy in belize citybelize defense force
US Navy 070912-N-0989H-035 Marines assigned to a mobile training team conduct a series of water exercises and pad drills with members of the Dominican Defense Force during Marine Corps small unit training
dominican republicarmy
US Navy 090209-N-5086M-005 Capt. Gregory Blaschke, medical director, Medical and Surgical Simulation Center at Naval Medical Center San Diego, right, demonstrates the mobile child trainer
naval medical center san diegomedical training dummies
US Navy 090322-N-3674H-156 Builder 1st Class William Potter, assigned to Naval Mobile Construction Battalion (NMCB) 74, ensures the level of a timber tower while directing a forklift during a field training exercise at Camp She
builder (united states navy)camp shelby
US Navy 090822-N-8816D-110 Chief Builder Brian Howard, quality control chief for Naval Mobile Construction Battalion (NMCB) 133, observes a mass casualty drill during a field training exercise at Camp Shelby, Miss
architecturecamp shelby
US Navy 110911-N-ZZ999-172 Quartermaster 3rd Class Andrew Harris and Religious Program Specialist 1st Class Johnathan Nutt fold the American flag a
folding of the national flag of the united states by military peopleaboard uss mobile bay (cg-53)
US Navy 081031-N-8816D-277 Construction Electrician 3rd Class Garett Birnbaum keeps a close watch from his camp's controlled entry point
naval mobile construction battalion 133m-240 machine gun
US Navy 070925-N-0989H-455 Members of the Jamaica Defense Force conduct Close Quarters Battle and room clearing drills with U.S. Marines assigned to a mobile training team during small unit training
united states navy in jamaicaroom clearing
US Navy 070927-N-4267W-284 Steelworker 3rd Class Doug Horox, with Naval Mobile Construction Battalion (NMCB) 7, low crawls through a stream during a jungle warfare training evolution hosted by Marines with the Jungle Warfare Tr
steelworker (united states navy)camp gonsalves
US Navy 070927-N-4267W-035 Culinary Specialist 3rd Class Gao Xiong, with Naval Mobile Construction Battalion (NMCB) 7, negotiates a rope bridge during a jungle warfare training evolution hosted by Marines with the Jungle Warfar
culinary specialist (united states navy)camp gonsalves
US Navy 040219-N-4142G-002 A front loader assigned to the Club and Spades of Naval Mobile Construction Battalion Two Five (NMCB 25), pours earth to be used in the building of a foundation at the Manuel Memorial El
united states navy images from puerto princesawood
US Navy 040225-N-4142G-017 Naval Mobile Construction Battalion Two Five (NMCB 25) and members of the Armed Forces of the Philippines (AFP) work on repairs of a deep well and water tank at the Bacungan Elementary School
united states navy images from puerto princesabalikatan 2004
US Navy 070125-N-0775Y-063 Chief Utilitiesman James Sherry instructs Equipment Operator Constructionman Albert Amozarrutia in the direction to continue cleaning during a runway repair exercise at Kadena Air Base, Okinawa
militaryarmy
US Navy 061203-N-0780F-001 Sailors of Mobile Security Detachment 32 load their equipment into a 50-foot workboat for embark on board Military Sealift Command (MSC) roll-on-roll-off ship USNS Soderman (T-AKR 317)
ships at naval support activity souda bay
US Navy 051205-N-1132S-018 New fathers assigned to Naval Mobile Construction Battalion Seven Four (NMCB-74) receives flowers as they return home from a six-month deployment to Okinawa, Japan
militaryaircraft
US Navy 070404-N-0775Y-021 Ship Serviceman 1st Class Ronald Umali, attached to Naval Mobile Construction Battalion (NMCB) 3 takes aim with an M-16 rifle during a weapons training course at Camp Shields
militaryarmy
Maas met zicht op Ammerzoden
north brabantmeuse
目黒区立烏森小学校
self-published workpages with maps
Московский монорельс 2004-02 Поломка контактного рельса 6
self-published workpages with maps
Cuan Tang Hot Pot 20150217
trafficcity
Defense.gov News Photo 101212-N-4440L-144 - Petty Officer 3rd Class Woodman Fleurizard and Petty Officer 3rd Class Shavonnah Magee both assigned to Naval Mobile Construction Battalion 74
combined joint task force horn of africadefense.gov news media for december 2010
CARAT 2013 130618-N-JN664-060
mobile diving and salvage unit 1vehicle
US Navy 090424-N-XXXXP-005 Naval Sea Systems Command pollution response experts supporting the U.S. Coast Guard conduct a dive to assess the remaining petroleum products aboard the ex-USS Chehalis (AOG-48)
pago pagowater
US Navy 070620-N-3857R-001 Personnel Specialist 3rd Class Ray Guedry, of Naval Mobile Construction Battalion (NMCB) 1, splices a communications wire in the ant farm of the battalion's forward operating base (FOB) during Operati
personnel specialist (united states navy)camp shelby
MAN truck of the Royal Netherlands Army with TRML -Telefunken Radar Mobil Luftraumüberwachung, pic1
luchtmachtdagen 2014cc-zero
Icon networks internet
hexagonicons
Business computer tablet
businesssymbol
Microwave radio antenna
technologyindustrial
Pizzochero
platefood
Peony - Arlington, MA
naturespring
Smoked oyster and cheddar cheese on Triscuit - Massachusetts
platefood
Simferopol trolleybus 2543 2021-05 depot
vehiclered
Simferopol trolleybus 2528 2021-05 Novoromanovka
self-published workvehicle
View from Shibuya Stream during covid, April 2021 15
cityscapecity
El Portón, Colonia del Sacramento
self-published workshopping
Dishes at Italian restaurant in Ebisu Garden Place 5
platefood
Mosckw trolleybus 1872 2020-07
self-published workvehicle
Map beside TOC buildings in Gotanda
self-published workcolors fade
Tengenji toll gate, garbage truck, bus stopping, under 首都高速2号目黒線
self-published workcc-zero
Tokyo Nakagin capsule tower 2019-04 fasade 2
skylinecity
Taco with refried beans, textured vegetable protein, salsa, guacamole, and cheese - Massachusetts
platefood
Rose 23
springplants
Reserved Parking disabled persons
self-published workpages with maps
RZD DM62-1745 2020-12 Vesyegonsk arrive 2
wintersnow
RZD ED9M-0090 2020-02 Adtrakhan-Aksarauskaya train
self-published workvehicle
RZD EM4-001 2004-02 Sputnik service frist day Yaroslavsky terminal
self-published workcolor
Toast with avocado, salsa, tomato, onion - Massachusetts
platefood
Tokyo 2020 Olympics in Ariake, police watching on top of industrial building in front of tennis center court
cityscapecity
Priory Lodge
self-published workarchitecture
Riga tram 30776 2020-03
tatra t3vehicle
Riga Tram depot 5 2020-03
self-published workvehicle
View from Shibuya Stream during covid, April 2021 12
cityscapecity
River near Skytree, at night
skylinecity
Давыдковская заброшенная больница, вид издалека
skylinecity
2014_South_Napa_earthquake_Sam_Kee_Laundry_Building_debris
self-published workpages with maps
Заказник_Степной_2020-02_13
vehiclecar
一本杉スキー場（秋、晴れ）_10
landscapenature
Санкт-Петербург_музейный_автобус_в160ас98
vehiclecity
Спартаковская_площадь_2020
cityscapecity
Улица_Победы,_астраханский_автобус_2020-02
skylinecity
МАЗ-504_2021-05_(square)
self-published workvehicle
ЗИЛ-4972_2021-05_(cropped)
self-published workvehicle
恵比寿ビール坂商店街
sidewalkcity
Генеральское_озеро,_Первомайка,_Раменский_округ_2021-05
landscapetree
Cranes rebuilding broken river bank
self-published workboat
Covid-19 prevention anti-hanami fencing at Yoyogi Park 3
grasstree
Enterprise touchdown Intrepid fr Pier 84 jeh
self-published workpages with maps
Flowers at Ebisu East Park
springtree
Ebeneser Chapel 2
architecturevillage
First Train at Sealdah Railway Station
trafficlight
HSZ TU-Dresden nachts
lightcity
20701 - 20800 of 26,108 Next page
/ 262